Lena Week 5 - Revision history

Lena: /* Reflections */

2013-09-27T00:25:26Z

‎Reflections

Lena: /* Reflections */ category

2013-09-27T00:25:07Z

‎Reflections: category

Lena: /* Reflections */ answered 2

2013-09-27T00:23:36Z

‎Reflections: answered 2

Lena: /* About the EGFR-HUMAN Protein */

2013-09-27T00:22:05Z

‎About the EGFR-HUMAN Protein

Lena: /* Reflections */

2013-09-27T00:07:55Z

‎Reflections

Lena: added bheadings

2013-09-27T00:02:03Z

added bheadings

Lena at 23:51, 26 September 2013

2013-09-26T23:51:13Z

Lena at 18:58, 26 September 2013

2013-09-26T18:58:09Z

Lena: RefSeq

2013-09-26T18:56:16Z

RefSeq

Lena: Pfam

2013-09-26T18:53:37Z

Pfam

@@ Line 114: / Line 114: @@
+:
 [[User:Lena|Lena]] ([[User talk:Lena|talk]]) 17:25, 26 September 2013 (PDT)
-:[[Category:Journal Enrty]]
+:[[Category:Journal Entry]]

← Older revision		Revision as of 00:25, 27 September 2013
Line 111:		Line 111:
	#I learned a bit about which cross-ref links I liked, and how to go about accessing information about a specific protein.		#I learned a bit about which cross-ref links I liked, and how to go about accessing information about a specific protein.
	#I think I understood the exercise, but the information being present by some of the cross-ref pages seems really in depth and over my head. I feel like I don't yet know how to interpret all the information I am receiving.		#I think I understood the exercise, but the information being present by some of the cross-ref pages seems really in depth and over my head. I feel like I don't yet know how to interpret all the information I am receiving.
		+
		+	:
		+	[[User:Lena\|Lena]] ([[User talk:Lena\|talk]]) 17:25, 26 September 2013 (PDT)
		+	:[[Category:Journal Enrty]]

@@ Line 108: / Line 108: @@
 ==Reflections==
-#The Purpose of the exercise was to get familiar with the layout and features of Uniprot, especially because we are going to be working with Uniprot a lot more this semester.
+#The purpose of the exercise was to get familiar with the layout and features of Uniprot, especially because we are going to be working with Uniprot a lot more this semester.
-#I Learned...
+#I learned a bit about which cross-ref links I liked, and how to go about accessing information about a specific protein.
 #I think I understood the exercise, but the information being present by some of the cross-ref pages seems really in depth and over my head.  I feel like I don't yet know how to interpret all the information I am receiving.

@@ Line 105: / Line 105: @@
+:
 ==About the EGFR-HUMAN Protein==
 ==Reflections==

← Older revision		Revision as of 00:07, 27 September 2013
Line 107:		Line 107:

	==Reflections==		==Reflections==
		+	#The Purpose of the exercise was to get familiar with the layout and features of Uniprot, especially because we are going to be working with Uniprot a lot more this semester.
		+	#I Learned...
		+	#I think I understood the exercise, but the information being present by some of the cross-ref pages seems really in depth and over my head. I feel like I don't yet know how to interpret all the information I am receiving.

← Older revision		Revision as of 00:02, 27 September 2013
Line 103:		Line 103:
	TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV		TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
	APQSSEFIGA		APQSSEFIGA
		+	:
		+	==About the EGFR-HUMAN Protein==
		+
		+	==Reflections==

@@ Line 4: / Line 4: @@
 [[Image:Lena1.PNG]]
+:
-*'''This is what the entry showed...'''
+*'''This is what the entry showed.  It it the main page containing general information about EGFR.'''
+:
 [[Image:Lena2.PNG]]
+:
+:
-*'''Clicked on EC 2.7.1.112 link, the link brought up this page'''
+*'''Clicked on EC 2.7.1.112 link, the link brought up this page.  This page can help a person figure out a protein's enzymatic function.'''
+:
+:
@@ Line 15: / Line 15: @@
+:
+:
-*'''I navigated back to the original page, then clicked on the Comments heading to see what the comments where.  I was directed to this page.'''
+*'''I navigated back to the original page, then clicked on the Comments heading to see what the comments where.  I was directed to this page.  The comments page hold useful information that just doesn't fit under any of the other headings.'''
+:
+:
@@ Line 21: / Line 21: @@
+:
+:
-*'''Again, I went back to the main page and scrolled down to the cross reference section.  I found InterPro and clicked on a link for Graphical View.  This is what I saw...'''
+*'''Again, I went back to the main page and scrolled down to the cross reference section.  I found InterPro and clicked on a link for Graphical View.  The page showed a visual for the domains and repeats of the protein.'''
@@ Line 31: / Line 31: @@
+:
+:
-*'''I also clicked on EMBL, this is the page that showed up.'''
+*'''I also clicked on EMBL, this is the page that showed up.  EMBL showed some basic information about the sequence I clicked on, and showed where repeats occured on the gene.'''
+:
+:
@@ Line 38: / Line 38: @@
+:
+:
-*'''I looked at PDB which gave an animation of the protein.'''
+*'''I looked at PDB which gave an animation of the protein.  I liked this page because it showed you the different domains on the protein.'''
+:
+:
@@ Line 45: / Line 45: @@
+:
+:
-*'''For the Pfam Link, this is what showed up.'''
+*'''For the Pfam Link, I clicked on the graphical view and got this.  The image shows the arrangement of Pfam domains on the P00533 sequence.'''
+:
-:[[Image:Lena11.PNG]]
+:[[Image:Pfam.PNG]]
+:
+:
-*'''I tried out RefSeq, which gave a list of papers where the sequence was referenced.'''
+*'''I tried out RefSeq, which gave a list of papers where the sequence was referenced.  This could be useful in finding out more for a research project.'''
+:
+:
 :[[Image:Lena12.PNG]]
+:
+:

@@ Line 53: / Line 53: @@
+:
+:
-:[[Image:Lena12]]
+:[[Image:Lena12.PNG]]
+:
+:

@@ Line 42: / Line 42: @@
+:
 [[Image:Lena10.PNG]]
+:
+: