Bklein7 Week 4 - Revision history

Bklein7: made grammar edit

2015-09-29T02:33:12Z

made grammar edit

Bklein7: edited image code

2015-09-29T02:32:12Z

edited image code

Bklein7: Added media

2015-09-29T02:30:14Z

Added media

@@ Line 123: / Line 123: @@
   MAKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR-
-*To verify that the above result was correct, I did some research. I learned that the infA gene in E. coli codes for the protein by the name of ''Translation initiation factor IF-1''. Using [[http://www.uniprot.org/uniprot/P69222 this database]], I found a graphic showing the amino acid sequence of Translation initiation factor IF-1.
+To verify that the above result was correct, I did some research. I learned that the infA gene in E. coli codes for the protein by the name of ''Translation initiation factor IF-1''. Using [[http://www.uniprot.org/uniprot/P69222 this database]], I found a graphic showing the amino acid sequence of Translation initiation factor IF-1.
 [[Image:AA Sequence.png]]

@@ Line 125: / Line 125: @@
 *To verify that the above result was correct, I did some research. I learned that the infA gene in E. coli codes for the protein by the name of ''Translation initiation factor IF-1''. Using [[http://www.uniprot.org/uniprot/P69222 this database]], I found a graphic showing the amino acid sequence of Translation initiation factor IF-1.
-[[Media:AA Sequence.png]]
+[[Image:AA Sequence.png]]
 ==Links==

@@ Line 105: / Line 105: @@
   uagucgcugauuguuuuaccgccugaugggcgaagagaaagaacgaguaaaaggucgguuuaaccggccuuuuuauu
 ===Determining the Translation Product (Part #3)===
-Translation begins at the start codon "aug" and ends at the stop codon, in this case "tga". The file ''genetic-code.sed'' can be used to apply the genetic code to an mRNA sequence as in week 3, but the above sequence must first be trimmed to begin with the start codon and end with the stop codon. There are many ways to do this. I chose to go back in the command sequence from part #2 and section off the sequence from the start codon to the stop codon before deleting the tags. After this, I reached back to the individual assignment from week 3 to get the command sequence for translation using the ''genetic-code.sed''. The specific alterations I made to the command sequence in part #2 are listed below:
+''Translation'' begins at the start codon "aug" and ends at the stop codon, in this case "tga". The file ''genetic-code.sed'' can be used to apply the genetic code to an mRNA sequence as in week 3, but the above sequence must first be trimmed to begin with the start codon and end with the stop codon. There are many ways to do this. I chose to go back in the command sequence from part #2 and section off the sequence from the start codon to the stop codon before deleting the tags. After this, I reached back to the individual assignment from week 3 to get the command sequence for translation using the ''genetic-code.sed''. The specific alterations I made to the command sequence in part #2 are listed below:
 #I deleted the last two commands in the sequence, which consisted of the following: <code> sed -r "s/\/|<|>//g;s/tss|rbs|start_codon|stop_codon|terminator//g" | sed "s/t/u/g"</code>.
 #I added a command to insert line breaks after the <code><start_codon></code> tag and before the <code></stop_codon></code> tag: <code>sed "s/<start_codon>/&\n/g;s/<\/stop_codon>/\n&/g"</code>.
@@ Line 124: / Line 124: @@
 *To verify that the above result was correct, I did some research. I learned that the infA gene in E. coli codes for the protein by the name of ''Translation initiation factor IF-1''. Using [[http://www.uniprot.org/uniprot/P69222 this database]], I found a graphic showing the amino acid sequence of Translation initiation factor IF-1.
 ==Links==