Bklein7 Week 3
From LMU BioDB 2015
Revision as of 00:29, 16 September 2015 by Bklein7 (Talk | contribs) (Outlined the questions and supplied initial answers)
Complement of a Strand
Write a sequence of piped text processing commands that, when given a nucleotide sequence, returns its complementary strand. In other words, fill in the question marks:
cat sequence_file | sed "y/atcg/tagc/"
Reading Frames
Write 6 sets of text processing commands that, when given a nucleotide sequence, returns the resulting amino acid sequence, one for each possible reading frame for the nucleotide sequence.
Outputs generated using ~dondi/xmlpipedb/data/prokaryote.txt:
- +1 Reading Frame
cat sequence_file | sed "s/t/u/g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: STIFQ-VRWPKKTILNLKRCLIPCSAYNPAASSAGGIL
- +2 Reading Frame
cat sequence_file | sed "s/t/u/g" | sed "s/^.//g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: LLYFNRYDGQRRQY-T-NVA-YHVPRITQPPVPLAAF-
- +3 Reading Frame
cat sequence_file | sed "s/t/u/g" | sed "s/^..//g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: YYISIGTMAKEDNIELETLPNTMFRV-PSRQFRWRHFN
- -1 Reading Frame
- -2 Reading Frame
- -3 Reading Frame
- Hint 1: The 6 sets of commands are very similar to each other.
- Hint 2: Under the ~dondi/xmlpipedb/data directory in the Keck lab, you will find a file called genetic-code.sed. To save you some typing, this file has already been prepared with the correct sequence of sed commands for converting any base triplets into the corresponding amino acid. For example, this line in that file:
s/ugc/C/g
...corresponds to a uracil-guanine-cytosine sequence transcribing to the cysteine amino acid (C). The trick is to figure out how to use this file to your advantage, in the commands that you'll be forming.
Check Your Work
Fortunately, online tools are available for checking your work; we recommend the ExPASy Translate Tool, sponsored by the same people who run SwissProt. You’re free to use this tool to see if your text processing commands produce the same results.