Bhamilton18 Week 4 - Revision history

Bhamilton18: Added table code for striped table.

2017-09-26T04:23:18Z

Added table code for striped table.

Bhamilton18: Changed bullet points for information on the code

2017-09-26T01:42:35Z

Changed bullet points for information on the code

Bhamilton18: Added links template

2017-09-26T01:19:31Z

Added links template

Bhamilton18: changed title of zip file

2017-09-25T22:22:05Z

changed title of zip file

Bhamilton18: Added protein sequence content as well as creating headers to split up content vs. coding

2017-09-25T22:21:11Z

Added protein sequence content as well as creating headers to split up content vs. coding

Bhamilton18: Inserted What was found for content

2017-09-25T22:16:36Z

Inserted What was found for content

Bhamilton18: typo fix

2017-09-25T22:02:26Z

typo fix

Bhamilton18: Added how to insert an image onto html page

2017-09-25T22:00:47Z

Added how to insert an image onto html page

Bhamilton18: Made code stand out on the page, reformatted bullet points

2017-09-25T21:56:31Z

Made code stand out on the page, reformatted bullet points

Bhamilton18: Fixed a typo

2017-09-25T21:46:14Z

Fixed a typo

@@ Line 56: / Line 56: @@
 :-The h1 represents the header and the "text-muted" represents the faded part of the text, as seen at the top of our website.
-*Table Section:
+*Table Section (Two Types):
   <nowiki><dl class="row"><dt class="col-sm-3">Standard Name:</dt>
    <dd class="col-sm-7">ASP1</dd>
@@ Line 62: / Line 62: @@
 :-The dl represents the creation of the table, and the dt represents the columns created. The col-sm-7 or 3 are where the text will be placed on the page, i.e. how far apart they are and what portion of the page with be covered.
 After Inserting the content in Unstyled lists under each question, I began adding stylistic changes.

@@ Line 48: / Line 48: @@
 *Color changes code:
   <nowiki><div class="p-3 mb-2 bg-info text-white">Content Questions</div></nowiki>
 *Initial Title with Faded Text:
   <nowiki><h1>ASP-1<small class="text-muted">The Gene of the Decade</small></h1></nowiki>
 *Table Section:
   <nowiki><dl class="row"><dt class="col-sm-3">Standard Name:</dt>
    <dd class="col-sm-7">ASP1</dd>
 </dl></nowiki>
 After Inserting the content in Unstyled lists under each question, I began adding stylistic changes.
 *Unstyled lists:
@@ Line 61: / Line 70: @@
    </ul>
 </ul> </nowiki>
 Then for inserting hyperlinks I followed Dr. Dionisio's template and did the following code:
   <nowiki> <a href=". . .">Description</a> </nowiki>
 When choosing a photo for our page we looked for uncopyrighted images on the ASP1 gene. We wanted to focus on a microscope shot to give an idea of the genes shape and size.
@@ Line 71: / Line 84: @@
        <figcaption class="figure-caption"> Image of Saccharomyces cerevisiae generated by a scanning electron microscope.</figcaption>
   </div> </nowiki>
 <nowiki>*</nowiki> See Reference/Acknowledgments Section for citations
 ==Current Zip File for "Our Favorite Gene" Website==

@@ Line 89: / Line 89: @@
 #L-asparaginase 1. (2017, July 05). Retrieved September 25, 2017, from http://www.uniprot.org/uniprot/P38986
 #Starr, B. (2017, March 2). Feed a Cold, Starve a Cancer? Retrieved September 25, 2017, from https://www.yeastgenome.org/blog/feed-a-cold-starve-a-cancer
 [[Category:Journal Entry]]

@@ Line 72: / Line 72: @@
   </div> </nowiki>
 <nowiki>*</nowiki> See Reference/Acknowledgments Section for citations
-==Current Website for "Our Favorite Gene"==
+==Current Zip File for "Our Favorite Gene" Website==
-#[[Media:Asp-1.zip| Katie and Blair's Website]]
+#[[Media:Asp-1.zip| Katie and Blair's Zip File]]
 ==Acknowledgments== <!--Crediting sources from which information, especially syntax, was borrowed-->
 #I utilized the [https://getbootstrap.com/docs/4.0/content/reboot/ Bootstrap Tutorial Page] for formatting help, table formation, image upload and unique style elements (i.e colors).

@@ Line 1: / Line 1: @@
 =Electronic Notebook for Week 4=
 To begin this assignment I utilized [[User:Dondi|Dr. Dionisio's]] starter zip file. The file came with a template of a chrome html page as well as an image. While creating our, Katie Wright and my's, website I used the html page as a template to start my own coding/editing, but deleted image that was linked to the URL.
@@ Line 6: / Line 7: @@
 Looking at each individual website we found the "content" needs.I.e. the standard name, systematic name, and name description for your gene,  gene ID (found on all 4 websites*), DNA sequence*, protein sequence*, function*, and located differences between each site. We found the following:
-#Standard name: ASP1
+*Standard name: ASP1
-#Systematic name: YDR321W
+*Systematic name: YDR321W
-#Name description for your gene: "This Gene codes for L-asparaginase, which depletes levels of L-asparagine by hydrolyzing L-ASP into aspartic acid and ammonia. This molecule can be used to treat acute lymphoblastic leukemia. It also has low glutaminase activity and dependence." (This portion was paraphrased by [[User:Kwrigh35|Katie Wright]] based on the [https://www.yeastgenome.org/locus/S000002729 SGD Overview Page])
+*Name description for your gene: "This Gene codes for L-asparaginase, which depletes levels of L-asparagine by hydrolyzing L-ASP into aspartic acid and ammonia. This molecule can be used to treat acute lymphoblastic leukemia. It also has low glutaminase activity and dependence." (This portion was paraphrased by [[User:Kwrigh35|Katie Wright]] based on the [https://www.yeastgenome.org/locus/S000002729 SGD Overview Page])
-#Gene ID: S000002729 (for SGD and Ensembl), P38986 (for UniProt) and 85192 (for NCBI)
+*Gene ID: S000002729 (for SGD and Ensembl), P38986 (for UniProt) and 85192 (for NCBI)
-#DNA sequence:
+*DNA sequence:
 ATGAAAAGCGATTCAGTTGAAATCACTACCATCTGCCCAGATGTTGAAAATTCTCAGTTT<br>
 GTTGTGCAAAGCAACTGTCCAGAGACTATTCCAGAGATTCTAAAGTCTCAAAATGCCGCT<br>
@@ Line 31: / Line 32: @@
 TGTTTGGCAGGTAACTACACGTTGGAAGAAATTAAACATGTTTTCACTGGCGTCTATGGT<br>
 GGGTGA
-#Protein sequence
+*Protein sequence:
-#Function
+MKSDSVEITTICPDVENSQFVVQSNCPETIPEILKSQNAAVNGS<br>
 Once the content was found, we began editing/coding our html page. First we utilized the Bootstrap website to find out a basis for formatting, image uploading and unique personal touches to the site. Unique touches such as color changes, the initial title of the page with the faded text, and the table section after the first question.
 *Color changes code:

@@ Line 1: / Line 1: @@
 =Electronic Notebook for Week 4=
-*To begin this assignment I utilized [[User:Dondi|Dr. Dionisio's]] starter zip file. The file came with a template of a chrome html page as well as an image. While creating our, Katie Wright and my's, website I used the html page as a template to start my own coding/editing, but deleted image that was linked to the URL.
+To begin this assignment I utilized [[User:Dondi|Dr. Dionisio's]] starter zip file. The file came with a template of a chrome html page as well as an image. While creating our, Katie Wright and my's, website I used the html page as a template to start my own coding/editing, but deleted image that was linked to the URL.
-*To begin, Katie and I began researching "our favorite gene" the ASP1 gene located on the SGD website, https://www.yeastgenome.org/locus/S000002729#reference
-**This website along with NCBI Gene Database, Ensembl, and UniProt, were used to complete this assignment.*
+To begin, Katie and I began researching "our favorite gene" the ASP1 gene located on the SGD website, https://www.yeastgenome.org/locus/S000002729#reference
-*Looking at each individual website we found the "content" needs.
+*This website along with NCBI Gene Database, Ensembl, and UniProt, were used to complete this assignment.*
-**I.e. the standard name, systematic name, and name description for your gene,  gene ID (found on all 4 websites*), DNA sequence*, protein sequence*, function*, and located differences between each site.
-*Once the content was found, we began editing/coding our html page. First we utilized the Bootstrap website to find out a basis for formatting, image uploading and unique personal touches to the site.
+Looking at each individual website we found the "content" needs.I.e. the standard name, systematic name, and name description for your gene,  gene ID (found on all 4 websites*), DNA sequence*, protein sequence*, function*, and located differences between each site. We found the following:
-** Unique touches such as color changes, the initial title of the page with the faded text, and the table section after the first question.
+#Standard name: ASP1
 *Color changes code:
   <nowiki><div class="p-3 mb-2 bg-info text-white">Content Questions</div></nowiki>
@@ Line 15: / Line 42: @@
    <dd class="col-sm-7">ASP1</dd>
 </dl></nowiki>
-*After Inserting the content in Unstyled lists under each question, I began adding stylistic changes.
+After Inserting the content in Unstyled lists under each question, I began adding stylistic changes.
-**Unstyled lists:
+*Unstyled lists:
   <nowiki><ul class="list-unstyled">
    <ul>
@@ Line 22: / Line 49: @@
    </ul>
 </ul> </nowiki>
-*Then for inserting hyperlinks I followed Dr. Dionisio's template and did the following code:
   <nowiki> <a href=". . .">Description</a> </nowiki>
-*When choosing a photo for our page we looked for uncopyrighted images on the ASP1 gene. We wanted to focus on a microscope shot to give an idea of the genes shape and size.
-*To insert the photo, we once again used Dr. Dionisio's template as well as the Bootstrap Tutorial in order to center the photo.
+When choosing a photo for our page we looked for uncopyrighted images on the ASP1 gene. We wanted to focus on a microscope shot to give an idea of the genes shape and size.
-**Here is the code:
+*To insert the photo, we once again used Dr. Dionisio's template as well as the Bootstrap Tutorial in order to center the photo.Here is the code:
   <nowiki> <div class="text-center">
        <img src="Saccharomyces_cerevisiae_SEM(640px).jpg" class="rounded" alt="Screenshot of ASP1 Gene">

@@ Line 12: / Line 12: @@
 #****<nowiki><h1>ASP-1<small class="text-muted">The Gene of the Decade</small></h1></nowiki>
 #***Table Section:
-#****<nowiki><dl class="row"><dt class="col-sm-3">Standard Name:</dt><dd class="col-sm-7">ASP1</dd></dl>
+#****<nowiki><dl class="row"><dt class="col-sm-3">Standard Name:</dt><dd class="col-sm-7">ASP1</dd></dl></nowiki>
 #*After Inserting the content in Unstyled lists under each question, I began adding stylistic changes.
 #**Unstyled lists: