CDC28/YBR160W Week 3 - Revision history

Dramir36: remove extra spacing

2019-09-19T06:34:59Z

remove extra spacing

Mavila9: /* Acknowledgments */ sign

2019-09-19T05:57:24Z

‎Acknowledgments: sign

Mavila9: /* Database Summaries */ summary change

2019-09-19T02:09:56Z

‎Database Summaries: summary change

Dramir36: /* References */ added references

2019-09-19T01:46:29Z

‎References: added references

Dramir36: added references and acknowledgements

2019-09-19T01:17:45Z

added references and acknowledgements

Dramir36: /* Gene ID */ rearranged order

2019-09-19T01:05:12Z

‎Gene ID: rearranged order

Dramir36: /* Reason Why CDC28 Was Chosen */ added more to the answer

2019-09-19T01:03:21Z

‎Reason Why CDC28 Was Chosen: added more to the answer

Dramir36: added the reason why CDC28 was chosen

2019-09-19T00:59:45Z

added the reason why CDC28 was chosen

Dramir36: /* Amino Acid Sequence */ added animo acid sequence image

2019-09-19T00:23:24Z

‎Amino Acid Sequence: added animo acid sequence image

Dramir36: /* Amino Acid Sequence */ added sequence

2019-09-19T00:07:17Z

‎Amino Acid Sequence: added sequence

@@ Line 93: / Line 93: @@
 *SGD contains less hyperlinks/annotations in the information than UniProt making SGD easier to read.
 *UniProt includes images for the catalytic activity & subcellular location of the gene, which is not done in any other database.
 ====Reason Why CDC28 Was Chosen====

← Older revision		Revision as of 05:57, 19 September 2019
Line 111:		Line 111:

	*Except for what is noted above, this individual journal entry was completed by me and not copied from another source. [[User:Dramir36\|Dramir36]] ([[User talk:Dramir36\|talk]]) 18:17, 18 September 2019 (PDT)		*Except for what is noted above, this individual journal entry was completed by me and not copied from another source. [[User:Dramir36\|Dramir36]] ([[User talk:Dramir36\|talk]]) 18:17, 18 September 2019 (PDT)
		+
		+	[[User:Mavila9\|Mavila9]] ([[User talk:Mavila9\|talk]]) 22:57, 18 September 2019 (PDT)

@@ Line 1: / Line 1: @@
-=== Database Summaries ===
+=== Database Summary ===
-==== [https://uswest.ensembl.org/Saccharomyces_cerevisiae/Gene/Summary?db=core;g=YBR160W;r=II:560078-560974;t=YBR160W_mRNA Ensembl] ====
+Known as cyclin-dependent kinase, or CDK, and is the master regulator of mitotic and meiotic cell cycles. CDK is associated with regulation of the G1, S, and G2/M phase cyclins, metabolism regulation, DNA to mRNA transcription regulation, chromosome changes/movement, and cellular morphogenesis. CDK also plays a role in osmostress by initiating transcription as a response. The CDC28 gene is translated into cyclin-dependent kinase 1 of Saccharomyces Cerivisiae. CDK1 is needed for initiation and controlling events in the cell cycle. It is also involved in various biological processes including, but not limited to, 7-methylguanosine mRNA capping, DNA double-strand break processing & repair via nonhomologous end joining, G1/S transition of the mitotic cell cycle, mitotic sister chromatid biorientation, mitotic spindle assembly, and negative regulation of meiotic & mitotic cell cycle. CDK1 interacts with CKS1 protein and with cyclin by forming a stable non-covalent complex.
 === Additional Information ===

@@ Line 106: / Line 106: @@
 ====References====
+#SIB. (n.d.). Translate. Retrieved September 18, 2019, from https://web.expasy.org/translate/
+#UniProt Consortium. (2019). UniProtKB. Retrieved September 18, 2019, from https://www.uniprot.org/uniprot/P00546
 ====Acknowledgments====

← Older revision		Revision as of 01:17, 19 September 2019
Line 104:		Line 104:

	Since the last memory of a gene came from the Cell Function course that was taken during the Fall semester of 2018, David thought about the importance of the CDK2 gene that is found in human cells, which has a purpose of regulating the process during the cell cycle. It was soon discovered that CDC28 is the yeast equivalent to CDK2 in humans. CDC28 is critical in yeast cells because the presence initiates the start of the cell cycle by activating specific transcription factors that switches on transcription during the late G1 phase. We were interested how the CDC28 gene is translated to amino acids to make up the proteins that are used during the cell cycle.		Since the last memory of a gene came from the Cell Function course that was taken during the Fall semester of 2018, David thought about the importance of the CDK2 gene that is found in human cells, which has a purpose of regulating the process during the cell cycle. It was soon discovered that CDC28 is the yeast equivalent to CDK2 in humans. CDC28 is critical in yeast cells because the presence initiates the start of the cell cycle by activating specific transcription factors that switches on transcription during the late G1 phase. We were interested how the CDC28 gene is translated to amino acids to make up the proteins that are used during the cell cycle.
		+
		+	====References====
		+
		+
		+
		+	====Acknowledgments====
		+
		+	*Dr. Dahlquist for the continued support in assisting and answering our questions during the making of this assignment.
		+
		+	*Except for what is noted above, this individual journal entry was completed by me and not copied from another source. [[User:Dramir36\|Dramir36]] ([[User talk:Dramir36\|talk]]) 18:17, 18 September 2019 (PDT)

@@ Line 21: / Line 21: @@
 ==== Gene ID ====
 *SGD:S000000364 [https://www.yeastgenome.org/locus/S000000364 SGD]
 *852457 [https://www.ncbi.nlm.nih.gov/gene/852457 NCBI]
 ==== Nucleotide Sequence ====

← Older revision		Revision as of 01:03, 19 September 2019
Line 103:		Line 103:
	====Reason Why CDC28 Was Chosen====		====Reason Why CDC28 Was Chosen====

−	Since the last memory of a gene came from the Cell Function course that was taken during the Fall semester of 2018, David thought about the importance of the CDK2 gene that is found in human cells, which has a purpose of regulating the process during the cell cycle. It was soon discovered that CDC28 is the yeast equivalent to CDK2 in humans. CDC28 is critical in yeast cells because the presence initiates the start of the cell cycle by activating specific transcription factors that switches on transcription during the late G1 phase.	+	Since the last memory of a gene came from the Cell Function course that was taken during the Fall semester of 2018, David thought about the importance of the CDK2 gene that is found in human cells, which has a purpose of regulating the process during the cell cycle. It was soon discovered that CDC28 is the yeast equivalent to CDK2 in humans. CDC28 is critical in yeast cells because the presence initiates the start of the cell cycle by activating specific transcription factors that switches on transcription during the late G1 phase. We were interested how the CDC28 gene is translated to amino acids to make up the proteins that are used during the cell cycle.

← Older revision		Revision as of 00:59, 19 September 2019
Line 99:		Line 99:
	*SGD contains less hyperlinks/annotations in the information than UniProt making SGD easier to read.		*SGD contains less hyperlinks/annotations in the information than UniProt making SGD easier to read.
	*UniProt includes images for the catalytic activity & subcellular location of the gene, which is not done in any other database.		*UniProt includes images for the catalytic activity & subcellular location of the gene, which is not done in any other database.
		+
		+
		+	====Reason Why CDC28 Was Chosen====
		+
		+	Since the last memory of a gene came from the Cell Function course that was taken during the Fall semester of 2018, David thought about the importance of the CDK2 gene that is found in human cells, which has a purpose of regulating the process during the cell cycle. It was soon discovered that CDC28 is the yeast equivalent to CDK2 in humans. CDC28 is critical in yeast cells because the presence initiates the start of the cell cycle by activating specific transcription factors that switches on transcription during the late G1 phase.

@@ Line 65: / Line 65: @@
 EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
 YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES
 ==== Gene Functions ====

← Older revision		Revision as of 00:07, 19 September 2019
Line 59:		Line 59:

	==== Amino Acid Sequence ====		==== Amino Acid Sequence ====
		+
		+	MSGELANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREIS
		+	LLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQL
		+	CKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAP
		+	EVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIV
		+	YLPDFKPSFPQWRRKDLSQVVPSLDPRGIDLLDKLLAYDPINRISARRAAIHPYFQES

	==== Gene Functions ====		==== Gene Functions ====