FAS2 Week 3 - Revision history

Msamdars: /* Acknowledgements */

2019-09-19T04:52:31Z

‎Acknowledgements

2019-09-19T04:51:06Z

‎Summary: add summary

2019-09-19T04:07:10Z

‎Differences Between Databases: add this

2019-09-19T03:13:16Z

‎Gene Image: imported image

2019-09-19T01:10:16Z

Clarification for protein sequence location

2019-09-19T00:59:06Z

‎Gene Function: add refs

2019-09-19T00:58:18Z

‎References: add reference

2019-09-19T00:57:19Z

‎Gene Function: add gene function

2019-09-17T01:44:22Z

‎Protein Sequence: Protein sequence image

2019-09-17T01:40:28Z

‎Protein Sequence

← Older revision		Revision as of 04:52, 19 September 2019
Line 174:		Line 174:

	Except for what is noted above, this individual journal entry was completed by me and not copied from another source.		Except for what is noted above, this individual journal entry was completed by me and not copied from another source.
		+
		+	[[User:Msamdars\|Msamdars]] ([[User talk:Msamdars\|talk]]) 21:52, 18 September 2019 (PDT)

	==References==		==References==

← Older revision		Revision as of 04:51, 19 September 2019
Line 1:		Line 1:
	==Summary==		==Summary==
		+	FAS2 is a gene that encodes for the alpha subunit of the fatty acid synthase. This proteins is particularly important as fatty acids are one of the most crucial molecules in a cell, involved in nearly every facet of a cell's function and metabolism. The gene is located on Chromosome XVI from positions 108652 to 114315 bp. It coordinates the binding of six beta subunits of the complex, which are encoded by the FAS1 gene. The alpha subunit contains 1894 amino acids.

	==Gene Info==		==Gene Info==

← Older revision		Revision as of 04:07, 19 September 2019
Line 160:		Line 160:

	===Differences Between Databases===		===Differences Between Databases===
		+	SGD seems to be the only database that contains gene expression data. However, I do not seem to find any major differences in content between the databases; the only difference that I could find was that the NCBI Gene database specified more Gene Ontology terms for our gene than any of the other databases. The NCBI Gene database seems to contain far less detailed Information about the gene, however it does provide the necessary information. Furthermore, it seems that many of these databases actually derive information from each other, as I can search for the gene in all the databases using any of the unique identifier codes from any of the databases. While SGD seems to contain far more information than the other databases, it seems that UniProt actually contains far more detailed information; however, UniProt does not seem to be manually curated as SGD is because much of the information that it displays it cites from other databases.

	===Why This Gene?===		===Why This Gene?===

← Older revision		Revision as of 03:13, 19 September 2019
Line 165:		Line 165:

	===Gene Image===		===Gene Image===
		+
		+	[[File:Firstglance_animation_1.gif]]

	==Acknowledgements==		==Acknowledgements==

@@ Line 154: / Line 154: @@
 </pre>
-[[Image:Protein_Sequence.PNG | thumb | Protein Sequence]]
+[[Image:Protein_Sequence.PNG | thumb | Protein Sequence (Frame 1 is the Protein Sequence)]]
 ===Gene Function===

@@ Line 157: / Line 157: @@
 ===Gene Function===
-This gene encodes the alpha subunit of the proteins fatty acid synthetase. The complex of the alpha subunit with the beta subunit (encoded by [https://www.yeastgenome.org/locus/S000001665 FAS1]) are responsible for the synthesis of 16- and 18-carbon long fatty acid chains from acetyl-CoA, malonyl-CoA, and NADPH. The product of this reaction is palmitic or stearic acid. This is then transferred to other organelles and further modified before being delivered to its final destination, whether the lipid membrane or some other destination.
+This gene encodes the alpha subunit of the proteins fatty acid synthetase. The complex of the alpha subunit with the beta subunit (encoded by [https://www.yeastgenome.org/locus/S000001665 FAS1]) are responsible for the synthesis of 16- and 18-carbon long fatty acid chains from acetyl-CoA, malonyl-CoA, and NADPH (Cherry et al., 2007). The product of this reaction is palmitic or stearic acid (Lomakin et al., 2007). This is then transferred to other organelles and further modified before being delivered to its final destination, whether the lipid membrane or some other destination.
 ===Differences Between Databases===

@@ Line 177: / Line 177: @@
 # Brown, G. R., Hem, V., Katz, K. S., Ovetsky, M., Wallin, C., Ermolaeva, O., ... & Murphy, T. D. (2014). Gene: a gene-centered information resource at NCBI. ''Nucleic Acids Research'', 43(D1), D36-D42.
 # Researchers identify the yeast genes behind rose and honeyed flavors in beer and wine (2017, November 7) retrieved 16 September 2019 from https://phys.org/news/2017-11-yeast-genes-rose- honeyed-flavors.html
 # de Carvalho, B. T., Holt, S., Souffriau, B., Brandão, R. L., Foulquié-Moreno, M. R., & Thevelein, J. M. (2017). Identification of novel alleles conferring superior production of rose flavor phenylethyl acetate using polygenic analysis in yeast. ''MBio'', 8(6), e01173-17.

← Older revision		Revision as of 00:57, 19 September 2019
Line 157:		Line 157:

	===Gene Function===		===Gene Function===
		+	This gene encodes the alpha subunit of the proteins fatty acid synthetase. The complex of the alpha subunit with the beta subunit (encoded by [https://www.yeastgenome.org/locus/S000001665 FAS1]) are responsible for the synthesis of 16- and 18-carbon long fatty acid chains from acetyl-CoA, malonyl-CoA, and NADPH. The product of this reaction is palmitic or stearic acid. This is then transferred to other organelles and further modified before being delivered to its final destination, whether the lipid membrane or some other destination.

	===Differences Between Databases===		===Differences Between Databases===

@@ Line 153: / Line 153: @@
 EAGVTDVKVSISHDDLQAVAVAVSTKK
 </pre>
 ===Gene Function===

@@ Line 119: / Line 119: @@
 ===Protein Sequence===
+<pre>
 MKPEVEQELAHILLTELLAYQFASPVRWIETQDVFLKDFNTERVVEIGPSPTLAGMAQRT
 LKNKYESYDAALSLHREILCYSKDAKEIYYTPDPSELAAKEEPAKEEAPAPTPAASAPAP
@@ Line 151: / Line 151: @@
 KDSYINANTIETAKMIENMTKEKVSNGGVGVDVELITSINVENDTFIERNFTPQEIEYCS
 AQPSVQSSFAGTWSAKEAVFKSLGVKSLGGGAALKDIEIVRVNKNAPAVELHGNAKKAAE
-EAGVTDVKVSISHDDLQAVAVAVSTKK*
+EAGVTDVKVSISHDDLQAVAVAVSTKK
 ===Gene Function===