Difference between revisions of "MSymond1 KMill104 Week 3"
Jump to navigation
Jump to search
(added more acknowledgements) |
(added wiki page to acknowledgements) |
||
| Line 16: | Line 16: | ||
NSRYVNDKQKVKQPIGWLCHSSHIPETLK | NSRYVNDKQKVKQPIGWLCHSSHIPETLK | ||
# Picture of structure[[image:MSN1.png|200px|thumb|right|]] | # Picture of structure[[image:MSN1.png|200px|thumb|right|]] | ||
| − | #Acknowledgements: The two homework partners, Katie and Dean, utilized each other for this assignment. They worked together in class for the assignment. This is the Wikipedia page that shows how to use "wikitext" | + | #Acknowledgements: The two homework partners, Katie and Dean, utilized each other for this assignment. They worked together in class for the assignment. This is the Wikipedia page that shows how to use "wikitext" [[https://en.wikipedia.org/wiki/Help:Wikitext#:~:text=The%20markup%20language%20called%20wikitext,edit%2C%20see%20Help%3AEditing.| Click here]] |
Revision as of 21:12, 30 January 2024
Summary
Additional Information
- The Standard name for the gene is MSN1, the systematic name for the gene is YOL116W, and the name description of the gene from SGD is Multicopy suppressor of SNF1 mutation.
- The gene ID's from the differing databases are as follows
- SGD:S000005476 SGD Page
- NIH:854033 NIH Page
- UniProt:P22148 Uniprot Page
- DNA sequence
- Protein Sequence
- MASNQHIGASNLNENEAILTNRVAELERRMSMFEGIFHALSNRLDLHFKKYDVVVNSQQQQINELTAFL
STLLNDQQRHAEILSEKLSGTLHGVSATSISLSQTLDPQGFTDGTTAPGAPRNYTSVPMNNDQTAHPQNEG AVSNETLFEDILNGNSQENDKSQQQTNSSNSISQENNSTNPSVDTRFNKPQNYNSNLVPSLEEYSANPPNN DGGQSQGLYISSNSSQSRQSPNLQKVSPNHENAVESNAQESVPTFEEEQYETKTGLKRKRIVCTRPFEFIK SPHSVMEVWKEYTEGVNGQPSIRKMEALYQTAWRRDPAVNKRYSRRKVLWKAIQTGLNRGYSLNYVVEILE NSRYVNDKQKVKQPIGWLCHSSHIPETLK
- Picture of structure
- Acknowledgements: The two homework partners, Katie and Dean, utilized each other for this assignment. They worked together in class for the assignment. This is the Wikipedia page that shows how to use "wikitext" [Click here]

