Difference between revisions of "Hivanson and Nstojan1 Week 3"
Jump to navigation
Jump to search
(edited answer) |
(→Other Information:: fixed some typos) |
||
| Line 32: | Line 32: | ||
RTASAQLEGGVHNLHSYEKRLHN- | RTASAQLEGGVHNLHSYEKRLHN- | ||
*What is the function of your gene? | *What is the function of your gene? | ||
| − | **The molecular function of IMD3 is that it enables IMP dehydrogenase activity as well as mRNA binding.It catalyzes ionsine 5’-phosphate to xanthosine 5’-phosphate and during the de novo synthesis of GTP it catalyzes the rate limiting step. | + | **The molecular function of IMD3 is that it enables IMP dehydrogenase activity as well as mRNA binding. It catalyzes ionsine 5’-phosphate to xanthosine 5’-phosphate, and during the de novo synthesis of GTP, it catalyzes the rate-limiting step. It is also known to play an important role in cell growth. |
*What was different about the information provided about your gene in each of the parent databases? | *What was different about the information provided about your gene in each of the parent databases? | ||
| − | ***SDG and Uniprot both provide a variety of in-depth information about the gene. The contents of their information is fairly similar, in particular UniProt has more visual images and charts/graphs compared to SDG. | + | ***SDG and Uniprot both provide a variety of in-depth information about the gene. The contents of their information is fairly similar, in particular UniProt has more visual images and charts/graphs compared to SDG. Ensembl contains generic information that just covers the basics such as a name, description, and type. |
**Were there differences in content, the information or data itself? | **Were there differences in content, the information or data itself? | ||
| − | ***There were some differences in content | + | ***There were some differences in content; Ensembl didn’t provide much information on the gene that would help one learn about it. On the other hand, UniProt has a lot of information that could be useful for a person studying the gene. |
**Were there differences in presentation of the information? | **Were there differences in presentation of the information? | ||
***Information across all of the four databases was similar in the way they convey information. Mostly by separating things into sections and using visuals when necessary. | ***Information across all of the four databases was similar in the way they convey information. Mostly by separating things into sections and using visuals when necessary. | ||
Revision as of 21:30, 31 January 2024
IMD3
Summary of Function:
Other Information:
- What is the standard name, systematic name, and name description for your gene (from SGD)?
- Standard name: IMD3
- Systematic name: YLR432W
- Name description: IMP Dehydrogenase
- What is the gene ID (identifier) for your gene in all four databases (SGD, NCBI Gene, Ensembl, UniProt)?
- What is the DNA sequence of your gene?
- ATGGCCGCCGTTAGAGACTACAAGACTGCCTTGGAATTCGCCAAGAGCTTACCAAGACTAGATGGTTTGTCTGTCCAGGAGTTGATGGACTCCAAGACCAGAGGTGGGTTGACTTATAACGACTTTTTGGTTTTGCCAGGTCTGGTTGATTTCCCATCTTCTGAAGTTAGCCTACAAACTAAGTTGACAAGGAATATCACTTTGAACACCCCATTCGTTTCCTCTCCAATGGACACCGTGACAGAATCAGAAATGGCCATCTTCATGGCTTTGTTGGGTGGTATCGGTTTTATTCACCACAACTGTACCCCAGAGGACCAAGCTGACATGGTCAGAAGAGTCAAGAACTATGAAAATGGGTTTATTAACAACCCTATAGTGATTTCCCCAACTACTACTGTGGGTGAAGCTAAGAGTATGAAGGAAAGATTTGGATTTTCCGGTTTCCCCGTTACAGAAGATGGTAAAAGAAACGGAAAATTGATGGGTATCGTCACTTCTCGTGATATTCAGTTCGTTGAAGACAACTCTTTGCTTGTTCAAGATGTTATGACCAAAAACCCTGTCACCGGTGCACAAGGTATTACATTGTCTGAAGGTAATGAAATTTTAAAGAAGATTAAAAAGGGTAAGCTATTGATTGTTGACGACAATGGTAACTTAGTTTCTATGCTTTCCAGAACTGATTTAATGAAAAATCAGAACTATCCATTGGCTTCTAAATCTGCCACCACCAAGCAACTGTTATGTGGTGCTGCTATCGGTACTATCGATGCTGATAAGGAAAGGTTAAGACTATTAGTCGAAGCAGGTTTGGATGTTGTTATCTTAGATTCCTCTCAAGGTAACTCTATTTTCCAATTGAACATGATCAAATGGATTAAAGAAACTTTCCCAGATTTGGAAATCATTGCTGGTAACGTTGCCACCAGAGAACAAGCTGCTAACTTGATTGCTGCCGGTGCCGATGGTTTAAGAATTGGTATGGGTTCAGGCTCTATTTGTATCACTCAAGAAGTTATGGCCTGTGGTAGACCACAAGGTACAGCCGTCTACAACGTGTGTGAATTTGCTAACCAATTCGGTATTCCATGTATGGCTGATGGTGGTGTTCAAAACATTGGTCATATTACCAAAGCTTTGGCTCTTGGTTCTTCTACTGTTATGATGGGTGGTATGTTAGCTGGTACTACTGAATCTCCTGGTGAATATTTCTATCAAGATGGTAAAAGATTGAAGGCATATCGTGGTATGGGTTCCATTGACGCCATGCAAAAGACTGGTACTAAAGGTAATGCATCTACCTCCCGTTACTTTTCCGAATCAGACAGTGTTTTGGTCGCACAAGGTGTCTCCGGTGCTGTCGTTGACAAAGGTTCTATCAAGAAATTTATTCCATATTTGTACAACGGTTTACAACATTCTTGTCAAGACATTGGTTACAAGTCCCTAACTTTATTAAAGGAAAATGTCCAAAGCGGTAAAGTTAGATTTGAATTTAGAACCGCTTCTGCTCAACTAGAAGGTGGTGTTCATAACTTACATTCTTACGAAAAGCGTTTACATAACTAA
- What is the protein sequence corresponding to your gene?
Reading frame 1 encodes the IMD3 protein sequence:
MAAVRDYKTALEFAKSLPRLDGLSVQELMDSKTRGGLTYNDFLVLPGLVD FPSSEVSLQTKLTRNITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHH NCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKERFGFSGFP VTEDGKRNGKLMGIVTSRDIQFVEDNSLLVQDVMTKNPVTGAQGITLSEG NEILKKIKKGKLLIVDDNGNLVSMLSRTDLMKNQNYPLASKSATTKQLLC GAAIGTIDADKERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETFPD LEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTA VYNVCEFANQFGIPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTES PGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQG VSGAVVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENVQSGKVRFEF RTASAQLEGGVHNLHSYEKRLHN-
- What is the function of your gene?
- The molecular function of IMD3 is that it enables IMP dehydrogenase activity as well as mRNA binding. It catalyzes ionsine 5’-phosphate to xanthosine 5’-phosphate, and during the de novo synthesis of GTP, it catalyzes the rate-limiting step. It is also known to play an important role in cell growth.
- What was different about the information provided about your gene in each of the parent databases?
- SDG and Uniprot both provide a variety of in-depth information about the gene. The contents of their information is fairly similar, in particular UniProt has more visual images and charts/graphs compared to SDG. Ensembl contains generic information that just covers the basics such as a name, description, and type.
- Were there differences in content, the information or data itself?
- There were some differences in content; Ensembl didn’t provide much information on the gene that would help one learn about it. On the other hand, UniProt has a lot of information that could be useful for a person studying the gene.
- Were there differences in presentation of the information?
- Information across all of the four databases was similar in the way they convey information. Mostly by separating things into sections and using visuals when necessary.
- Why did you choose your particular gene? i.e., why is it interesting to you and your partner?
- Hailey’s research in Dr. Sarah Mitchell’s lab at LMU studies IMD3’s RNA binding function in yeast.
- Include an image related to your gene (be careful that you do not violate any copyright restrictions!)
