Difference between revisions of "Hivanson and Nstojan1 Week 3"
Jump to navigation
Jump to search
(→Other Information:: my thoughts and feelings on differences in the databases) |
(→Acknowledgments: added acknowledgments) |
||
| Line 42: | Line 42: | ||
[[Image:Firstglance imd3.png]] | [[Image:Firstglance imd3.png]] | ||
===Acknowledgments=== | ===Acknowledgments=== | ||
| + | Database, A. P. S. (n.d.). Alphafold protein structure database. https://alphafold.ebi.ac.uk/entry/A0A816ADP2 | ||
| + | |||
===References=== | ===References=== | ||
Revision as of 21:55, 31 January 2024
IMD3
Summary of Function:
Other Information:
- What is the standard name, systematic name, and name description for your gene (from SGD)?
- Standard name: IMD3
- Systematic name: YLR432W
- Name description: IMP Dehydrogenase
- What is the gene ID (identifier) for your gene in all four databases (SGD, NCBI Gene, Ensembl, UniProt)?
- SGD ID:S000004424 SGD:
- Gene ID: 851152 NCBI Gene Database:
- UniProtKB ID: P50095 Ensembl:
- UniProtKB ID: P50095 UniProt:
- What is the DNA sequence of your gene?
- ATGGCCGCCGTTAGAGACTACAAGACTGCCTTGGAATTCGCCAAGAGCTTACCAAGACTAGATGGTTTGTCTGTCCAGGAGTTGATGGACTCCAAGACCAGAGGTGGGTTGACTTATAACGACTTTTTGGTTTTGCCAGGTCTGGTTGATTTCCCATCTTCTGAAGTTAGCCTACAAACTAAGTTGACAAGGAATATCACTTTGAACACCCCATTCGTTTCCTCTCCAATGGACACCGTGACAGAATCAGAAATGGCCATCTTCATGGCTTTGTTGGGTGGTATCGGTTTTATTCACCACAACTGTACCCCAGAGGACCAAGCTGACATGGTCAGAAGAGTCAAGAACTATGAAAATGGGTTTATTAACAACCCTATAGTGATTTCCCCAACTACTACTGTGGGTGAAGCTAAGAGTATGAAGGAAAGATTTGGATTTTCCGGTTTCCCCGTTACAGAAGATGGTAAAAGAAACGGAAAATTGATGGGTATCGTCACTTCTCGTGATATTCAGTTCGTTGAAGACAACTCTTTGCTTGTTCAAGATGTTATGACCAAAAACCCTGTCACCGGTGCACAAGGTATTACATTGTCTGAAGGTAATGAAATTTTAAAGAAGATTAAAAAGGGTAAGCTATTGATTGTTGACGACAATGGTAACTTAGTTTCTATGCTTTCCAGAACTGATTTAATGAAAAATCAGAACTATCCATTGGCTTCTAAATCTGCCACCACCAAGCAACTGTTATGTGGTGCTGCTATCGGTACTATCGATGCTGATAAGGAAAGGTTAAGACTATTAGTCGAAGCAGGTTTGGATGTTGTTATCTTAGATTCCTCTCAAGGTAACTCTATTTTCCAATTGAACATGATCAAATGGATTAAAGAAACTTTCCCAGATTTGGAAATCATTGCTGGTAACGTTGCCACCAGAGAACAAGCTGCTAACTTGATTGCTGCCGGTGCCGATGGTTTAAGAATTGGTATGGGTTCAGGCTCTATTTGTATCACTCAAGAAGTTATGGCCTGTGGTAGACCACAAGGTACAGCCGTCTACAACGTGTGTGAATTTGCTAACCAATTCGGTATTCCATGTATGGCTGATGGTGGTGTTCAAAACATTGGTCATATTACCAAAGCTTTGGCTCTTGGTTCTTCTACTGTTATGATGGGTGGTATGTTAGCTGGTACTACTGAATCTCCTGGTGAATATTTCTATCAAGATGGTAAAAGATTGAAGGCATATCGTGGTATGGGTTCCATTGACGCCATGCAAAAGACTGGTACTAAAGGTAATGCATCTACCTCCCGTTACTTTTCCGAATCAGACAGTGTTTTGGTCGCACAAGGTGTCTCCGGTGCTGTCGTTGACAAAGGTTCTATCAAGAAATTTATTCCATATTTGTACAACGGTTTACAACATTCTTGTCAAGACATTGGTTACAAGTCCCTAACTTTATTAAAGGAAAATGTCCAAAGCGGTAAAGTTAGATTTGAATTTAGAACCGCTTCTGCTCAACTAGAAGGTGGTGTTCATAACTTACATTCTTACGAAAAGCGTTTACATAACTAA
- What is the protein sequence corresponding to your gene?
Reading frame 1 encodes the IMD3 protein sequence:
MAAVRDYKTALEFAKSLPRLDGLSVQELMDSKTRGGLTYNDFLVLPGLVD FPSSEVSLQTKLTRNITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHH NCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKERFGFSGFP VTEDGKRNGKLMGIVTSRDIQFVEDNSLLVQDVMTKNPVTGAQGITLSEG NEILKKIKKGKLLIVDDNGNLVSMLSRTDLMKNQNYPLASKSATTKQLLC GAAIGTIDADKERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETFPD LEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTA VYNVCEFANQFGIPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTES PGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQG VSGAVVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENVQSGKVRFEF RTASAQLEGGVHNLHSYEKRLHN-
- What is the function of your gene?
- The molecular function of IMD3 is that it enables IMP dehydrogenase activity as well as mRNA binding. It catalyzes ionsine 5’-phosphate to xanthosine 5’-phosphate during the de novo synthesis of GTP. It is also known to play an important role in cell growth.
- What was different about the information provided about your gene in each of the parent databases?
- SDG and Uniprot both provide a variety of in-depth information about the gene. The contents of their information is fairly similar, in particular UniProt has more visual images and charts/graphs compared to SDG. Ensembl contains generic information that just covers the basics such as a name, description, and type.
- There were some differences in content; Ensembl and NCBI didn’t provide much information on the gene that would help one learn about it. On the other hand, UniProt and SGD have a lot of information that could be useful for a person studying IMD3 and its functions.
- Information across all of the four databases was similar in the way they convey information. Mostly by separating things into sections and using visuals when necessary. Notably, SGD had a fun visual for comparative information and UniProt had an equally fun visual to show the subcellular location of IMD3. While all sites were navigable, some were more user-friendly than others; UniProt was outstanding in this with an attractive and intuitive UI while Ensembl was lacking.
- Why did you choose your particular gene? i.e., why is it interesting to you and your partner?
- Hailey’s research in Dr. Sarah Mitchell’s lab at LMU studies IMD3’s RNA binding function in yeast.
- Include an image related to your gene (be careful that you do not violate any copyright restrictions!)
Acknowledgments
Database, A. P. S. (n.d.). Alphafold protein structure database. https://alphafold.ebi.ac.uk/entry/A0A816ADP2

