Hivanson and Nstojan1 Week 3

From LMU BioDB 2024
Revision as of 18:16, 31 January 2024 by Hivanson (talk | contribs) (IMD3: expasy is causing little issues idk why i didn't just preview last time.)
Jump to navigation Jump to search

IMD3

Summary of Function:

Other Information:

  1. What is the standard name, systematic name, and name description for your gene (from SGD)?
    • Standard name: IMD3
    • Systematic name: YLR432W
    • Name description: IMP Dehydrogenase
  2. What is the gene ID (identifier) for your gene in all four databases (SGD, NCBI Gene, Ensembl, UniProt)?
  3. What is the DNA sequence of your gene?
  4. What is the protein sequence corresponding to your gene?

IMD3 ExPasy.png

Reading frame 1 encodes the IMD3 protein sequence:

MAAVRDYKTALEFAKSLPRLDGLSVQELMDSKTRGGLTYNDFLVLPGLVD FPSSEVSLQTKLTRNITLNTPFVSSPMDTVTESEMAIFMALLGGIGFIHH NCTPEDQADMVRRVKNYENGFINNPIVISPTTTVGEAKSMKERFGFSGFP VTEDGKRNGKLMGIVTSRDIQFVEDNSLLVQDVMTKNPVTGAQGITLSEG NEILKKIKKGKLLIVDDNGNLVSMLSRTDLMKNQNYPLASKSATTKQLLC GAAIGTIDADKERLRLLVEAGLDVVILDSSQGNSIFQLNMIKWIKETFPD LEIIAGNVATREQAANLIAAGADGLRIGMGSGSICITQEVMACGRPQGTA VYNVCEFANQFGIPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTES PGEYFYQDGKRLKAYRGMGSIDAMQKTGTKGNASTSRYFSESDSVLVAQG VSGAVVDKGSIKKFIPYLYNGLQHSCQDIGYKSLTLLKENVQSGKVRFEF RTASAQLEGGVHNLHSYEKRLHN-

  1. What is the function of your gene?
  2. What was different about the information provided about your gene in each of the parent databases?
    • Were there differences in content, the information or data itself?
    • Were there differences in presentation of the information?
  3. Why did you choose your particular gene? i.e., why is it interesting to you and your partner?
  4. Include an image related to your gene (be careful that you do not violate any copyright restrictions!)
    • Please make the image something scientific (not like the random images seen on the SGD blog posts).
    • If a 3D structure of the protein your gene encodes is available, you can choose to embed a rotating image of the structure on your page using the FirstGlance in Jmol software. This is optional, a different static image would be OK, too.
    • The NCBI Structure database and RSCB Protein Databank also display structures.