Difference between revisions of "Bklein7 Week 3"
From LMU BioDB 2015
(Added the section on XMLPipeDB Match practice) |
(Added a links section and the journal entry category) |
||
| Line 83: | Line 83: | ||
#* Explain why the counts are different. | #* Explain why the counts are different. | ||
#**Piggybacking on the aside above, I decided to see if the sequence ''atg'' existed more than once in a single line in the grep output. Therefore, I used the command sequence <code>grep "ATG" hs_ref_GRCh37_chr19.fa | more</code> to view a truncated version of the grep output. In the very first output line, I identified two occurrences of the sequence "atg": GGGACAGGCCCT'''ATG''' CTGCCACCTGTACATGCTATCTGAAGGACAGCCTCCAGGGCACACAGAGG'''ATG'''GT. Therefore, it becomes apparent that the pipe command linking together ''grep'' and ''wc'' was merely counting the number of '''lines''' in which the sequence ''atg'' appeared and not the unique number of times the '''pattern''' ''atg'' was present in the file. Conversely, the XMLPipeDB Match Utility is counting the number of times the three character pattern itself was present in the file. | #**Piggybacking on the aside above, I decided to see if the sequence ''atg'' existed more than once in a single line in the grep output. Therefore, I used the command sequence <code>grep "ATG" hs_ref_GRCh37_chr19.fa | more</code> to view a truncated version of the grep output. In the very first output line, I identified two occurrences of the sequence "atg": GGGACAGGCCCT'''ATG''' CTGCCACCTGTACATGCTATCTGAAGGACAGCCTCCAGGGCACACAGAGG'''ATG'''GT. Therefore, it becomes apparent that the pipe command linking together ''grep'' and ''wc'' was merely counting the number of '''lines''' in which the sequence ''atg'' appeared and not the unique number of times the '''pattern''' ''atg'' was present in the file. Conversely, the XMLPipeDB Match Utility is counting the number of times the three character pattern itself was present in the file. | ||
| + | ==Links== | ||
| + | {{Template:Bklein7}} | ||
| + | |||
| + | [[Category:Journal Entry]] | ||
Revision as of 00:15, 21 September 2015
Contents
The Genetic Code, by Computer
Complement of a Strand
Write a sequence of piped text processing commands that, when given a nucleotide sequence, returns its complementary strand. In other words, fill in the question marks:
cat sequence_file | sed "y/atcg/tagc/"
Reading Frames
Write 6 sets of text processing commands that, when given a nucleotide sequence, returns the resulting amino acid sequence, one for each possible reading frame for the nucleotide sequence.
Outputs generated using ~dondi/xmlpipedb/data/prokaryote.txt:
- +1 Reading Frame
cat sequence_file | sed "s/t/u/g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: STIFQ-VRWPKKTILNLKRCLIPCSAYNPAASSAGGIL
- +2 Reading Frame
cat sequence_file | sed "s/t/u/g" | sed "s/^.//g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: LLYFNRYDGQRRQY-T-NVA-YHVPRITQPPVPLAAF-
- +3 Reading Frame
cat sequence_file | sed "s/t/u/g" | sed "s/^..//g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: YYISIGTMAKEDNIELETLPNTMFRV-PSRQFRWRHFN
- -1 Reading Frame
cat sequence_file | sed "y/atcg/tagc/" | sed "s/t/u/g" | rev | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: VKMPPAELAAGLYAEHGIRQRFKENIVFFGHRTY-NIV
- -2 Reading Frame
cat sequence_file | sed "y/atcg/tagc/" | sed "s/t/u/g" | rev | sed "s/^.//g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: LKCRQRNWRLGYTRNMVLGNVSSSILSSLAIVPIEI--
- -3 Reading Frame
cat sequence_file | sed "y/atcg/tagc/" | sed "s/t/u/g" | rev | sed "s/^..//g" | sed "s/.../& /g" | sed -f genetic-code.sed | sed "s/[atcg]//g" | sed "s/ //g" Output: -NAASGTGGWVIRGTWY-ATFQVQYCLLWPSYLLKYSR
Check Your Work
The ExPASy Translate Tool was used to confirm that the output sequences generated above were accurate translations. Below is the output generated by ExPASy for the same nucleotide sequence adapted from prokaryote.txt.
XMLPipeDB Match Practice
To begin this assignment, I accessed the directory ~dondi/xmlpipedb/data.
- What Match command tallies the occurrences of the pattern
GO:000[567]in the 493.P_falciparum.xml file?- The necessary command and it's output are listed below:
java -jar xmlpipedb-match-1.1.1.jar GO:000[567] <493.P_falciparum.xmlgo:0007: 113go:0006: 1100go:0005: 1371Total unique matches: 3
- How many unique matches are there?
- Referencing the output above, there are 3 unique matches.
- How many times does each unique match appear?
- The unique match
go:0005appeared 1371 times. The unique matchgo:0006appeared 1100 times. The unique matchgo:0007appeared 113 times.
- The unique match
- The necessary command and it's output are listed below:
- Try to find one such occurrence “in situ” within that file. Look at the neighboring content around that occurrence.
- In order to find occurrences of the patterns matched above within their original positions in the file 493.P_falciparum.xml, we can use the grep command. This command will search for a specific keyword and provide "in situ" occurrence as an output.
- The command I used to do this and it's initial outputs are listed below:
grep "GO:0005" 493.P_falciparum.xml<dbReference type="GO" id="GO:0005884"><dbReference type="GO" id="GO:0005737">
- Based on where you find this occurrence, what kind of information does this pattern represent?
- This pattern appears to represent an id number under the general category of "GO". A quick skim of the file using the more function reveals many nucleotide sequences and references to genes. When accompanied with a quick google search, I deduced that this could stand for "Gene Oncology" id's-unique identifiers for the genes. This was confirmed when referencing the wiki page on Using the XMLPipeDB Match Utility.
- What Match command tallies the occurrences of the pattern
\"Yu.*\"in the 493.P_falciparum.xml file?- The necessary command and it's output are listed below:
java -jar xmlpipedb-match-1.1.1.jar \"Yu.*\" <493.P_falciparum.xml"yu b.": 1"yu k.": 228"yu m.": 1Total unique matches: 3
- How many unique matches are there?
- Referencing the above output, there are 3 unique matches.
- How many times does each unique match appear?
- The unique match
"yu b."occurred 1 time. The unique match"yu k."occurred 228 times. The unique match"yu m."occurred 1 time.
- The unique match
- What information do you think this pattern represents?
- This information appears to represent the names of different article authors as would be referenced in an APA citation (last name, abbreviated first name).
- This deduction was confirmed using the command
grep "Yu.*" 493.P_falciparum.xml, which yielded outputs such as<person name="Yu K."/>.
- The necessary command and it's output are listed below:
- Use Match to count the occurrences of the pattern
ATGin the hs_ref_GRCh37_chr19.fa file (this may take a while). Then, use grep and wc to do the same thing.- What answer does Match give you?
- The command
java -jar xmlpipedb-match-1.1.1.jar ATG < hs_ref_GRCh37_chr19.fayielded the outputatg:830101. Thus, Match identified the nucleotide sequence atg 830101 unique times in the above file.
- The command
- What answer does grep + wc give you?
- The command
grep "ATG" hs_ref_GRCh37_chr19.fa | wcyielded the output502410 502410 35671048. The first and second output values, representing line # and word # respectively, both suggest that the sequence atg exists 502410 times in the file. This is less than was yielded by the XMLPipeDB Match Utility. As an aside, it seems strange that the line and word numbers are exactly the same, as this sequence could potentially exists more than one time per line. Particularly when it occurs so many times in the file.
- The command
- Explain why the counts are different.
- Piggybacking on the aside above, I decided to see if the sequence atg existed more than once in a single line in the grep output. Therefore, I used the command sequence
grep "ATG" hs_ref_GRCh37_chr19.fa | moreto view a truncated version of the grep output. In the very first output line, I identified two occurrences of the sequence "atg": GGGACAGGCCCTATG CTGCCACCTGTACATGCTATCTGAAGGACAGCCTCCAGGGCACACAGAGGATGGT. Therefore, it becomes apparent that the pipe command linking together grep and wc was merely counting the number of lines in which the sequence atg appeared and not the unique number of times the pattern atg was present in the file. Conversely, the XMLPipeDB Match Utility is counting the number of times the three character pattern itself was present in the file.
- Piggybacking on the aside above, I decided to see if the sequence atg existed more than once in a single line in the grep output. Therefore, I used the command sequence
- What answer does Match give you?
Links
- User Page: Brandon Klein
- Team Page: The Class Whoopers
Assignments Pages
- Week 1 Assignment
- Week 2 Assignment
- Week 3 Assignment
- Week 4 Assignment
- Week 5 Assignment
- Week 6 Assignment
- Week 7 Assignment
- Week 8 Assignment
- Week 9 Assignment
- Week 10 Assignment
- Week 11 Assignment
- Week 12 Assignment
- No Week 13 Assignment
- Week 14 Assignment
- Week 15 Assignment
Individual Journal Entries
- Week 1 Individual Journal
- Week 2 Individual Journal
- Week 3 Individual Journal
- Week 4 Individual Journal
- Week 5 Individual Journal
- Week 6 Individual Journal
- Week 7 Individual Journal
- Week 8 Individual Journal
- Week 9 Individual Journal
- Week 10 Individual Journal
- Week 11 Individual Journal
- Week 12 Individual Journal
- No Week 13 Journal
- Week 14 Individual Journal
- Week 15 Individual Journal
- Week 1 Class Journal
- Week 2 Class Journal
- Week 3 Class Journal
- Week 4 Class Journal
- Week 5 Class Journal
- Week 6 Class Journal
- Week 7 Class Journal
- Week 8 Class Journal
- Week 9 Class Journal
- Week 10 Team Journal
- Week 11 Team Journal
- Week 12 Team Journal
- No Week 13 Journal
- Week 14 Team Journal
- Week 15 Team Journal
